Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralR-orzP/- |
| Location | 2669440..2669811 | Replicon | chromosome |
| Accession | NZ_CP122588 | ||
| Organism | Escherichia coli strain ETEC6335 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A839BBC2 |
| Locus tag | QDY30_RS13065 | Protein ID | WP_021500490.1 |
| Coordinates | 2669440..2669634 (+) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | orzP | ||
| Locus tag | - | ||
| Coordinates | 2669633..2669811 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY30_RS13045 (2664570) | 2664570..2664740 | + | 171 | WP_065336296.1 | YdaE family protein | - |
| QDY30_RS13050 (2664815) | 2664815..2665090 | + | 276 | WP_001372690.1 | hypothetical protein | - |
| QDY30_RS13055 (2665190) | 2665190..2668312 | + | 3123 | WP_000105090.1 | exodeoxyribonuclease VIII | - |
| QDY30_RS13060 (2668324) | 2668324..2669376 | + | 1053 | WP_001004412.1 | RecT family recombinase | - |
| QDY30_RS13065 (2669440) | 2669440..2669634 | + | 195 | WP_021500490.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| - (2669633) | 2669633..2669811 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2669633) | 2669633..2669811 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2669633) | 2669633..2669811 | - | 179 | NuclAT_1 | - | Antitoxin |
| - (2669633) | 2669633..2669811 | - | 179 | NuclAT_1 | - | Antitoxin |
| QDY30_RS13070 (2669627) | 2669627..2669815 | + | 189 | WP_001372676.1 | DUF1187 family protein | - |
| QDY30_RS13075 (2669915) | 2669915..2670130 | + | 216 | WP_000079604.1 | excisionase XisR | - |
| QDY30_RS13080 (2670132) | 2670132..2671367 | + | 1236 | WP_024168543.1 | site-specific integrase | - |
| QDY30_RS13085 (2671419) | 2671419..2672354 | + | 936 | WP_001157377.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| QDY30_RS13090 (2672483) | 2672483..2673856 | - | 1374 | WP_000123733.1 | ATP-dependent RNA helicase DbpA | - |
| QDY30_RS13095 (2673886) | 2673886..2674059 | - | 174 | WP_001296046.1 | protein YnaL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2623330..2678625 | 55295 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.98 Da Isoelectric Point: 9.2886
>T277245 WP_021500490.1 NZ_CP122588:2669440-2669634 [Escherichia coli]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT277245 NZ_CP122588:c2669811-2669633 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCCGATTTGGTTAACTTTGTTTTTGAGTACCTTGTCCAGCTGGTAGGAGAACCACCTTCCTTTT
CAATAGTGGCGGTGATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
