Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 641693..642492 | Replicon | chromosome |
Accession | NZ_CP122588 | ||
Organism | Escherichia coli strain ETEC6335 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A161R7C1 |
Locus tag | QDY30_RS03095 | Protein ID | WP_000347278.1 |
Coordinates | 641693..642157 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDY30_RS03100 | Protein ID | WP_001307405.1 |
Coordinates | 642157..642492 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY30_RS03065 (636694) | 636694..637128 | - | 435 | WP_028132083.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDY30_RS03070 (637146) | 637146..638024 | - | 879 | WP_086259429.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDY30_RS03075 (638014) | 638014..638793 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDY30_RS03080 (638804) | 638804..639277 | - | 474 | WP_001626031.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDY30_RS03085 (639300) | 639300..640580 | - | 1281 | WP_086259428.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDY30_RS03090 (640829) | 640829..641638 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QDY30_RS03095 (641693) | 641693..642157 | - | 465 | WP_000347278.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDY30_RS03100 (642157) | 642157..642492 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDY30_RS03105 (642641) | 642641..644212 | - | 1572 | WP_086259427.1 | galactarate dehydratase | - |
QDY30_RS03110 (644587) | 644587..645921 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDY30_RS03115 (645937) | 645937..646707 | + | 771 | WP_282866108.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17866.28 Da Isoelectric Point: 9.6924
>T277234 WP_000347278.1 NZ_CP122588:c642157-641693 [Escherichia coli]
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A161R7C1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |