Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 736317..737092 | Replicon | chromosome |
Accession | NZ_CP122587 | ||
Organism | Klebsiella pneumoniae strain NCRE-61 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QDV36_RS07870 | Protein ID | WP_004150910.1 |
Coordinates | 736607..737092 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QDV36_RS07865 | Protein ID | WP_004150912.1 |
Coordinates | 736317..736610 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV36_RS07845 (QDV36_07840) | 731524..732126 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
QDV36_RS07850 (QDV36_07845) | 732224..733136 | + | 913 | Protein_719 | LysR family transcriptional regulator | - |
QDV36_RS07855 (QDV36_07850) | 733137..734285 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
QDV36_RS07860 (QDV36_07855) | 734296..735672 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QDV36_RS07865 (QDV36_07860) | 736317..736610 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QDV36_RS07870 (QDV36_07865) | 736607..737092 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QDV36_RS07875 (QDV36_07870) | 737796..738389 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QDV36_RS07880 (QDV36_07875) | 738486..738702 | + | 217 | Protein_725 | transposase | - |
QDV36_RS07885 (QDV36_07880) | 739308..740180 | + | 873 | WP_004188557.1 | ParA family protein | - |
QDV36_RS07890 (QDV36_07885) | 740180..740563 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QDV36_RS07895 (QDV36_07890) | 740556..741923 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 738486..738638 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T277221 WP_004150910.1 NZ_CP122587:736607-737092 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |