Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 350415..351061 | Replicon | chromosome |
Accession | NZ_CP122587 | ||
Organism | Klebsiella pneumoniae strain NCRE-61 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W8UNE1 |
Locus tag | QDV36_RS05805 | Protein ID | WP_002920560.1 |
Coordinates | 350415..350762 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QDV36_RS05810 | Protein ID | WP_002920557.1 |
Coordinates | 350762..351061 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV36_RS05795 (QDV36_05790) | 346341..347774 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
QDV36_RS05800 (QDV36_05795) | 347792..350239 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QDV36_RS05805 (QDV36_05800) | 350415..350762 | + | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDV36_RS05810 (QDV36_05805) | 350762..351061 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QDV36_RS05815 (QDV36_05810) | 351124..352632 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
QDV36_RS05820 (QDV36_05815) | 352837..353166 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QDV36_RS05825 (QDV36_05820) | 353217..354047 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
QDV36_RS05830 (QDV36_05825) | 354097..354855 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T277220 WP_002920560.1 NZ_CP122587:350415-350762 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |