277219

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324226..324812 Replicon chromosome
Accession NZ_CP122587
Organism Klebsiella pneumoniae strain NCRE-61

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QDV36_RS05695 Protein ID WP_002920800.1
Coordinates 324444..324812 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QDV36_RS05690 Protein ID WP_002920802.1
Coordinates 324226..324447 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV36_RS05670 (QDV36_05665) 320383..321309 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QDV36_RS05675 (QDV36_05670) 321306..322583 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
QDV36_RS05680 (QDV36_05675) 322580..323347 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QDV36_RS05685 (QDV36_05680) 323349..324062 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QDV36_RS05690 (QDV36_05685) 324226..324447 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDV36_RS05695 (QDV36_05690) 324444..324812 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDV36_RS05700 (QDV36_05695) 325085..326401 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QDV36_RS05705 (QDV36_05700) 326508..327395 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QDV36_RS05710 (QDV36_05705) 327392..328237 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QDV36_RS05715 (QDV36_05710) 328239..329309 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321306..330046 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T277219 WP_002920800.1 NZ_CP122587:324444-324812 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT277219 WP_002920802.1 NZ_CP122587:324226-324447 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References