Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 327690..328276 | Replicon | chromosome |
| Accession | NZ_CP122578 | ||
| Organism | Klebsiella pneumoniae strain KP-2683-1 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A330WAT7 |
| Locus tag | QDV38_RS04400 | Protein ID | WP_014906830.1 |
| Coordinates | 327908..328276 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | QDV38_RS04395 | Protein ID | WP_004174006.1 |
| Coordinates | 327690..327911 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV38_RS04375 (323847) | 323847..324773 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QDV38_RS04380 (324770) | 324770..326047 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| QDV38_RS04385 (326044) | 326044..326811 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QDV38_RS04390 (326813) | 326813..327526 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QDV38_RS04395 (327690) | 327690..327911 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDV38_RS04400 (327908) | 327908..328276 | + | 369 | WP_014906830.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDV38_RS04405 (328549) | 328549..329865 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QDV38_RS04410 (329972) | 329972..330859 | + | 888 | WP_014906831.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QDV38_RS04415 (330856) | 330856..331701 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| QDV38_RS04420 (331703) | 331703..332773 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 324770..333510 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13537.95 Da Isoelectric Point: 8.6410
>T277200 WP_014906830.1 NZ_CP122578:327908-328276 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A330WAT7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |