Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327690..328276 Replicon chromosome
Accession NZ_CP122578
Organism Klebsiella pneumoniae strain KP-2683-1

Toxin (Protein)


Gene name doc Uniprot ID A0A330WAT7
Locus tag QDV38_RS04400 Protein ID WP_014906830.1
Coordinates 327908..328276 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QDV38_RS04395 Protein ID WP_004174006.1
Coordinates 327690..327911 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV38_RS04375 (323847) 323847..324773 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QDV38_RS04380 (324770) 324770..326047 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QDV38_RS04385 (326044) 326044..326811 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QDV38_RS04390 (326813) 326813..327526 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QDV38_RS04395 (327690) 327690..327911 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDV38_RS04400 (327908) 327908..328276 + 369 WP_014906830.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDV38_RS04405 (328549) 328549..329865 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QDV38_RS04410 (329972) 329972..330859 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QDV38_RS04415 (330856) 330856..331701 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QDV38_RS04420 (331703) 331703..332773 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324770..333510 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(28-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13537.95 Da        Isoelectric Point: 8.6410

>T277200 WP_014906830.1 NZ_CP122578:327908-328276 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT277200 WP_004174006.1 NZ_CP122578:327690-327911 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A330WAT7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References