Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 57413..58140 | Replicon | plasmid pKP-2683-1-vir |
| Accession | NZ_CP122574 | ||
| Organism | Klebsiella pneumoniae strain KP-2683-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | QDV38_RS00290 | Protein ID | WP_011251285.1 |
| Coordinates | 57829..58140 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QDV38_RS00285 | Protein ID | WP_011251286.1 |
| Coordinates | 57413..57832 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV38_RS00255 (QDV38_00255) | 52581..53051 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| QDV38_RS00260 (QDV38_00260) | 53364..53999 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| QDV38_RS00265 (QDV38_00265) | 54418..55038 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| QDV38_RS00270 (QDV38_00270) | 55059..55847 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| QDV38_RS00275 (QDV38_00275) | 55861..56226 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| QDV38_RS00280 (QDV38_00280) | 56298..57266 | - | 969 | WP_011251287.1 | IS5 family transposase | - |
| QDV38_RS00285 (QDV38_00285) | 57413..57832 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QDV38_RS00290 (QDV38_00290) | 57829..58140 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QDV38_RS00295 (QDV38_00295) | 58345..58782 | - | 438 | Protein_58 | DDE-type integrase/transposase/recombinase | - |
| QDV38_RS00300 (QDV38_00300) | 58917..59614 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| QDV38_RS00305 (QDV38_00305) | 59616..60065 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| QDV38_RS00310 (QDV38_00310) | 60082..60393 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| QDV38_RS00315 (QDV38_00315) | 60407..60748 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| QDV38_RS00320 (QDV38_00320) | 60808..61764 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| QDV38_RS00325 (QDV38_00325) | 61944..62456 | + | 513 | WP_041937817.1 | hypothetical protein | - |
| QDV38_RS00330 (QDV38_00330) | 62564..63079 | + | 516 | WP_041937820.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..229269 | 229269 | |
| - | inside | IScluster/Tn | - | - | 47292..59614 | 12322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T277196 WP_011251285.1 NZ_CP122574:c58140-57829 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT277196 WP_011251286.1 NZ_CP122574:c57832-57413 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|