Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 57413..58140 Replicon plasmid pKP-2683-1-vir
Accession NZ_CP122574
Organism Klebsiella pneumoniae strain KP-2683-1

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag QDV38_RS00290 Protein ID WP_011251285.1
Coordinates 57829..58140 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QDV38_RS00285 Protein ID WP_011251286.1
Coordinates 57413..57832 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV38_RS00255 (QDV38_00255) 52581..53051 - 471 WP_048333570.1 hypothetical protein -
QDV38_RS00260 (QDV38_00260) 53364..53999 - 636 WP_223171879.1 hypothetical protein -
QDV38_RS00265 (QDV38_00265) 54418..55038 + 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
QDV38_RS00270 (QDV38_00270) 55059..55847 + 789 WP_040217257.1 hypothetical protein -
QDV38_RS00275 (QDV38_00275) 55861..56226 + 366 WP_048333448.1 hypothetical protein -
QDV38_RS00280 (QDV38_00280) 56298..57266 - 969 WP_011251287.1 IS5 family transposase -
QDV38_RS00285 (QDV38_00285) 57413..57832 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
QDV38_RS00290 (QDV38_00290) 57829..58140 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
QDV38_RS00295 (QDV38_00295) 58345..58782 - 438 Protein_58 DDE-type integrase/transposase/recombinase -
QDV38_RS00300 (QDV38_00300) 58917..59614 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
QDV38_RS00305 (QDV38_00305) 59616..60065 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
QDV38_RS00310 (QDV38_00310) 60082..60393 + 312 WP_011251282.1 hypothetical protein -
QDV38_RS00315 (QDV38_00315) 60407..60748 + 342 WP_011251281.1 hypothetical protein -
QDV38_RS00320 (QDV38_00320) 60808..61764 + 957 WP_011251280.1 DsbA family protein -
QDV38_RS00325 (QDV38_00325) 61944..62456 + 513 WP_041937817.1 hypothetical protein -
QDV38_RS00330 (QDV38_00330) 62564..63079 + 516 WP_041937820.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA 1..229269 229269
- inside IScluster/Tn - - 47292..59614 12322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T277196 WP_011251285.1 NZ_CP122574:c58140-57829 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT277196 WP_011251286.1 NZ_CP122574:c57832-57413 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References