Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 737218..737993 | Replicon | chromosome |
Accession | NZ_CP122573 | ||
Organism | Klebsiella pneumoniae strain KP2185 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QDV37_RS07505 | Protein ID | WP_004150910.1 |
Coordinates | 737508..737993 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QDV37_RS07500 | Protein ID | WP_004150912.1 |
Coordinates | 737218..737511 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDV37_RS07480 (QDV37_07480) | 732425..733027 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
QDV37_RS07485 (QDV37_07485) | 733125..734037 | + | 913 | Protein_721 | LysR family transcriptional regulator | - |
QDV37_RS07490 (QDV37_07490) | 734038..735186 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
QDV37_RS07495 (QDV37_07495) | 735197..736573 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QDV37_RS07500 (QDV37_07500) | 737218..737511 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QDV37_RS07505 (QDV37_07505) | 737508..737993 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QDV37_RS07510 (QDV37_07510) | 738697..739290 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QDV37_RS07515 (QDV37_07515) | 739387..739603 | + | 217 | Protein_727 | transposase | - |
QDV37_RS07520 (QDV37_07520) | 740209..741081 | + | 873 | WP_004188557.1 | ParA family protein | - |
QDV37_RS07525 (QDV37_07525) | 741081..741464 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QDV37_RS07530 (QDV37_07530) | 741457..742824 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 739387..739539 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T277184 WP_004150910.1 NZ_CP122573:737508-737993 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |