Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 324350..324936 | Replicon | chromosome |
| Accession | NZ_CP122573 | ||
| Organism | Klebsiella pneumoniae strain KP2185 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | QDV37_RS05320 | Protein ID | WP_002920800.1 |
| Coordinates | 324568..324936 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0H3GZM4 |
| Locus tag | QDV37_RS05315 | Protein ID | WP_002920802.1 |
| Coordinates | 324350..324571 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDV37_RS05295 (QDV37_05295) | 320507..321433 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QDV37_RS05300 (QDV37_05300) | 321430..322707 | + | 1278 | WP_002920806.1 | branched chain amino acid ABC transporter permease LivM | - |
| QDV37_RS05305 (QDV37_05305) | 322704..323471 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QDV37_RS05310 (QDV37_05310) | 323473..324186 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QDV37_RS05315 (QDV37_05315) | 324350..324571 | + | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDV37_RS05320 (QDV37_05320) | 324568..324936 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDV37_RS05325 (QDV37_05325) | 325209..326159 | + | 951 | Protein_298 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QDV37_RS05335 (QDV37_05335) | 326928..327302 | + | 375 | Protein_300 | extracellular solute-binding protein | - |
| QDV37_RS05340 (QDV37_05340) | 327409..328296 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QDV37_RS05345 (QDV37_05345) | 328293..329138 | + | 846 | WP_002920789.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 321430..330947 | 9517 | ||
| - | flank | IS/Tn | - | - | 326175..326678 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T277182 WP_002920800.1 NZ_CP122573:324568-324936 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZM4 |