277182

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324350..324936 Replicon chromosome
Accession NZ_CP122573
Organism Klebsiella pneumoniae strain KP2185

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QDV37_RS05320 Protein ID WP_002920800.1
Coordinates 324568..324936 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QDV37_RS05315 Protein ID WP_002920802.1
Coordinates 324350..324571 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDV37_RS05295 (QDV37_05295) 320507..321433 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QDV37_RS05300 (QDV37_05300) 321430..322707 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
QDV37_RS05305 (QDV37_05305) 322704..323471 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QDV37_RS05310 (QDV37_05310) 323473..324186 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QDV37_RS05315 (QDV37_05315) 324350..324571 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDV37_RS05320 (QDV37_05320) 324568..324936 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDV37_RS05325 (QDV37_05325) 325209..326159 + 951 Protein_298 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QDV37_RS05335 (QDV37_05335) 326928..327302 + 375 Protein_300 extracellular solute-binding protein -
QDV37_RS05340 (QDV37_05340) 327409..328296 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QDV37_RS05345 (QDV37_05345) 328293..329138 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321430..330947 9517
- flank IS/Tn - - 326175..326678 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T277182 WP_002920800.1 NZ_CP122573:324568-324936 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT277182 WP_002920802.1 NZ_CP122573:324350-324571 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References