Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 3969811..3970466 | Replicon | chromosome |
Accession | NZ_CP122540 | ||
Organism | Pseudomonas brenneri strain K5-sn1400 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QDY63_RS18460 | Protein ID | WP_032857392.1 |
Coordinates | 3969811..3970155 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A5B2UU43 |
Locus tag | QDY63_RS18465 | Protein ID | WP_032857393.1 |
Coordinates | 3970152..3970466 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY63_RS18450 (QDY63_18450) | 3966569..3968101 | + | 1533 | WP_029293337.1 | NADH-quinone oxidoreductase subunit M | - |
QDY63_RS18455 (QDY63_18455) | 3968109..3969572 | + | 1464 | WP_029293335.1 | NADH-quinone oxidoreductase subunit NuoN | - |
QDY63_RS18460 (QDY63_18460) | 3969811..3970155 | + | 345 | WP_032857392.1 | toxin | Toxin |
QDY63_RS18465 (QDY63_18465) | 3970152..3970466 | + | 315 | WP_032857393.1 | transcriptional regulator | Antitoxin |
QDY63_RS18470 (QDY63_18470) | 3970553..3972295 | - | 1743 | WP_032857394.1 | ABC transporter substrate-binding protein | - |
QDY63_RS18475 (QDY63_18475) | 3972462..3972734 | - | 273 | WP_029293327.1 | DUF2160 domain-containing protein | - |
QDY63_RS18480 (QDY63_18480) | 3972745..3973545 | - | 801 | WP_032857395.1 | carbohydrate ABC transporter permease | - |
QDY63_RS18485 (QDY63_18485) | 3973556..3974422 | - | 867 | WP_032857398.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13511.52 Da Isoelectric Point: 10.0671
>T277167 WP_032857392.1 NZ_CP122540:3969811-3970155 [Pseudomonas brenneri]
MDALFIELPPFERYRKDYLTDELFHGFQQELMKNPEAGAVMEGTGGLRKLRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLSPQHKKALKHMLDREIKARGFT
MDALFIELPPFERYRKDYLTDELFHGFQQELMKNPEAGAVMEGTGGLRKLRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLSPQHKKALKHMLDREIKARGFT
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|