Detailed information of TA system TA277160

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 93570..93996
• Replicon: plasmid pSCMY2
• Accession: NZ_CP122518
• Organism: Escherichia coli strain MY1-8

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QCL60_RS23425
• Protein ID: WP_001372321.1
• Coordinates: 93570..93695 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	93772..93996 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QCL60_RS23385 (88944)	88944..89633	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
QCL60_RS23390 (89820)	89820..90203	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QCL60_RS23395 (90536)	90536..91126	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
QCL60_RS23400 (91423)	91423..92244	-	822	WP_001234426.1	DUF932 domain-containing protein	-
QCL60_RS23405 (92362)	92362..92649	-	288	WP_000107535.1	hypothetical protein	-
QCL60_RS23410 (92674)	92674..92880	-	207	WP_000547968.1	hypothetical protein	-
QCL60_RS23415 (92950)	92950..93122	+	173	Protein_104	hypothetical protein	-
QCL60_RS23420 (93120)	93120..93350	-	231	WP_071586998.1	hypothetical protein	-
QCL60_RS23425 (93570)	93570..93695	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QCL60_RS23430 (93637)	93637..93786	-	150	Protein_107	plasmid maintenance protein Mok	-
- (93772)	93772..93996	-	225	NuclAT_0	-	Antitoxin
- (93772)	93772..93996	-	225	NuclAT_0	-	Antitoxin
- (93772)	93772..93996	-	225	NuclAT_0	-	Antitoxin
- (93772)	93772..93996	-	225	NuclAT_0	-	Antitoxin
QCL60_RS23435 (93808)	93808..93996	+	189	WP_001299721.1	hypothetical protein	-
QCL60_RS23440 (93965)	93965..94727	-	763	Protein_109	plasmid SOS inhibition protein A	-
QCL60_RS23445 (94724)	94724..95158	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
QCL60_RS23450 (95213)	95213..95410	-	198	Protein_111	hypothetical protein	-
QCL60_RS23455 (95438)	95438..95671	-	234	WP_000005987.1	DUF905 family protein	-
QCL60_RS23460 (95739)	95739..96278	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
QCL60_RS23465 (96304)	96304..96510	-	207	WP_000275856.1	hypothetical protein	-
QCL60_RS23470 (96580)	96580..96660	+	81	Protein_115	hypothetical protein	-
QCL60_RS23475 (96843)	96843..97012	-	170	Protein_116	hypothetical protein	-
QCL60_RS23480 (97649)	97649..98620	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..125049	125049

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277160 WP_001372321.1 NZ_CP122518:c93695-93570 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT277160 NZ_CP122518:c93996-93772 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin