Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 55241..55495 | Replicon | plasmid pSCMY2 |
| Accession | NZ_CP122518 | ||
| Organism | Escherichia coli strain MY1-8 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QCL60_RS23190 | Protein ID | WP_001312851.1 |
| Coordinates | 55241..55390 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 55434..55495 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCL60_RS23150 (50483) | 50483..50782 | - | 300 | Protein_51 | incFII family plasmid replication initiator RepA | - |
| QCL60_RS23155 (50869) | 50869..51615 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QCL60_RS23160 (51630) | 51630..53171 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QCL60_RS23165 (53363) | 53363..53926 | - | 564 | Protein_54 | plasmid replication initiator RepA | - |
| QCL60_RS23170 (53919) | 53919..54401 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| QCL60_RS23175 (54394) | 54394..54441 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| QCL60_RS23180 (54432) | 54432..54683 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| QCL60_RS23185 (54700) | 54700..54957 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QCL60_RS23190 (55241) | 55241..55390 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (55434) | 55434..55495 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55434) | 55434..55495 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55434) | 55434..55495 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (55434) | 55434..55495 | + | 62 | NuclAT_1 | - | Antitoxin |
| QCL60_RS23195 (55751) | 55751..55825 | - | 75 | Protein_60 | endonuclease | - |
| QCL60_RS23200 (56071) | 56071..56283 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QCL60_RS23205 (56419) | 56419..56979 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QCL60_RS23210 (57082) | 57082..57942 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| QCL60_RS23215 (58001) | 58001..58747 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..125049 | 125049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T277155 WP_001312851.1 NZ_CP122518:c55390-55241 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT277155 NZ_CP122518:55434-55495 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
