Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2682016..2682236 Replicon chromosome
Accession NZ_CP122517
Organism Escherichia coli strain MY1-8

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QCL60_RS13000 Protein ID WP_000170965.1
Coordinates 2682129..2682236 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2682016..2682082 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCL60_RS12975 2677295..2678689 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
QCL60_RS12980 2678874..2679227 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QCL60_RS12985 2679271..2679966 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QCL60_RS12990 2680124..2680354 - 231 WP_001146442.1 putative cation transport regulator ChaB -
QCL60_RS12995 2680624..2681724 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2682016..2682082 - 67 - - Antitoxin
QCL60_RS13000 2682129..2682236 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2682549..2682612 - 64 NuclAT_33 - -
- 2682549..2682612 - 64 NuclAT_33 - -
- 2682549..2682612 - 64 NuclAT_33 - -
- 2682549..2682612 - 64 NuclAT_33 - -
- 2682549..2682612 - 64 NuclAT_36 - -
- 2682549..2682612 - 64 NuclAT_36 - -
- 2682549..2682612 - 64 NuclAT_36 - -
- 2682549..2682612 - 64 NuclAT_36 - -
- 2682549..2682612 - 64 NuclAT_39 - -
- 2682549..2682612 - 64 NuclAT_39 - -
- 2682549..2682612 - 64 NuclAT_39 - -
- 2682549..2682612 - 64 NuclAT_39 - -
- 2682549..2682612 - 64 NuclAT_42 - -
- 2682549..2682612 - 64 NuclAT_42 - -
- 2682549..2682612 - 64 NuclAT_42 - -
- 2682549..2682612 - 64 NuclAT_42 - -
- 2682549..2682612 - 64 NuclAT_45 - -
- 2682549..2682612 - 64 NuclAT_45 - -
- 2682549..2682612 - 64 NuclAT_45 - -
- 2682549..2682612 - 64 NuclAT_45 - -
- 2682549..2682612 - 64 NuclAT_48 - -
- 2682549..2682612 - 64 NuclAT_48 - -
- 2682549..2682612 - 64 NuclAT_48 - -
- 2682549..2682612 - 64 NuclAT_48 - -
- 2682550..2682612 - 63 NuclAT_50 - -
- 2682550..2682612 - 63 NuclAT_50 - -
- 2682550..2682612 - 63 NuclAT_50 - -
- 2682550..2682612 - 63 NuclAT_50 - -
- 2682550..2682612 - 63 NuclAT_53 - -
- 2682550..2682612 - 63 NuclAT_53 - -
- 2682550..2682612 - 63 NuclAT_53 - -
- 2682550..2682612 - 63 NuclAT_53 - -
- 2682550..2682612 - 63 NuclAT_56 - -
- 2682550..2682612 - 63 NuclAT_56 - -
- 2682550..2682612 - 63 NuclAT_56 - -
- 2682550..2682612 - 63 NuclAT_56 - -
- 2682551..2682612 - 62 NuclAT_15 - -
- 2682551..2682612 - 62 NuclAT_15 - -
- 2682551..2682612 - 62 NuclAT_15 - -
- 2682551..2682612 - 62 NuclAT_15 - -
- 2682551..2682612 - 62 NuclAT_18 - -
- 2682551..2682612 - 62 NuclAT_18 - -
- 2682551..2682612 - 62 NuclAT_18 - -
- 2682551..2682612 - 62 NuclAT_18 - -
- 2682551..2682612 - 62 NuclAT_21 - -
- 2682551..2682612 - 62 NuclAT_21 - -
- 2682551..2682612 - 62 NuclAT_21 - -
- 2682551..2682612 - 62 NuclAT_21 - -
- 2682551..2682612 - 62 NuclAT_24 - -
- 2682551..2682612 - 62 NuclAT_24 - -
- 2682551..2682612 - 62 NuclAT_24 - -
- 2682551..2682612 - 62 NuclAT_24 - -
- 2682551..2682612 - 62 NuclAT_27 - -
- 2682551..2682612 - 62 NuclAT_27 - -
- 2682551..2682612 - 62 NuclAT_27 - -
- 2682551..2682612 - 62 NuclAT_27 - -
- 2682551..2682612 - 62 NuclAT_30 - -
- 2682551..2682612 - 62 NuclAT_30 - -
- 2682551..2682612 - 62 NuclAT_30 - -
- 2682551..2682612 - 62 NuclAT_30 - -
QCL60_RS13005 2682665..2682772 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2683085..2683150 - 66 NuclAT_32 - -
- 2683085..2683150 - 66 NuclAT_32 - -
- 2683085..2683150 - 66 NuclAT_32 - -
- 2683085..2683150 - 66 NuclAT_32 - -
- 2683085..2683150 - 66 NuclAT_35 - -
- 2683085..2683150 - 66 NuclAT_35 - -
- 2683085..2683150 - 66 NuclAT_35 - -
- 2683085..2683150 - 66 NuclAT_35 - -
- 2683085..2683150 - 66 NuclAT_38 - -
- 2683085..2683150 - 66 NuclAT_38 - -
- 2683085..2683150 - 66 NuclAT_38 - -
- 2683085..2683150 - 66 NuclAT_38 - -
- 2683085..2683150 - 66 NuclAT_41 - -
- 2683085..2683150 - 66 NuclAT_41 - -
- 2683085..2683150 - 66 NuclAT_41 - -
- 2683085..2683150 - 66 NuclAT_41 - -
- 2683085..2683150 - 66 NuclAT_44 - -
- 2683085..2683150 - 66 NuclAT_44 - -
- 2683085..2683150 - 66 NuclAT_44 - -
- 2683085..2683150 - 66 NuclAT_44 - -
- 2683085..2683150 - 66 NuclAT_47 - -
- 2683085..2683150 - 66 NuclAT_47 - -
- 2683085..2683150 - 66 NuclAT_47 - -
- 2683085..2683150 - 66 NuclAT_47 - -
- 2683086..2683152 - 67 NuclAT_49 - -
- 2683086..2683152 - 67 NuclAT_49 - -
- 2683086..2683152 - 67 NuclAT_49 - -
- 2683086..2683152 - 67 NuclAT_49 - -
- 2683086..2683152 - 67 NuclAT_52 - -
- 2683086..2683152 - 67 NuclAT_52 - -
- 2683086..2683152 - 67 NuclAT_52 - -
- 2683086..2683152 - 67 NuclAT_52 - -
- 2683086..2683152 - 67 NuclAT_55 - -
- 2683086..2683152 - 67 NuclAT_55 - -
- 2683086..2683152 - 67 NuclAT_55 - -
- 2683086..2683152 - 67 NuclAT_55 - -
- 2683087..2683150 - 64 NuclAT_14 - -
- 2683087..2683150 - 64 NuclAT_14 - -
- 2683087..2683150 - 64 NuclAT_14 - -
- 2683087..2683150 - 64 NuclAT_14 - -
- 2683087..2683150 - 64 NuclAT_17 - -
- 2683087..2683150 - 64 NuclAT_17 - -
- 2683087..2683150 - 64 NuclAT_17 - -
- 2683087..2683150 - 64 NuclAT_17 - -
- 2683087..2683150 - 64 NuclAT_20 - -
- 2683087..2683150 - 64 NuclAT_20 - -
- 2683087..2683150 - 64 NuclAT_20 - -
- 2683087..2683150 - 64 NuclAT_20 - -
- 2683087..2683150 - 64 NuclAT_23 - -
- 2683087..2683150 - 64 NuclAT_23 - -
- 2683087..2683150 - 64 NuclAT_23 - -
- 2683087..2683150 - 64 NuclAT_23 - -
- 2683087..2683150 - 64 NuclAT_26 - -
- 2683087..2683150 - 64 NuclAT_26 - -
- 2683087..2683150 - 64 NuclAT_26 - -
- 2683087..2683150 - 64 NuclAT_26 - -
- 2683087..2683150 - 64 NuclAT_29 - -
- 2683087..2683150 - 64 NuclAT_29 - -
- 2683087..2683150 - 64 NuclAT_29 - -
- 2683087..2683150 - 64 NuclAT_29 - -
QCL60_RS13010 2683200..2683307 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
QCL60_RS13015 2683456..2684310 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QCL60_RS13020 2684346..2685155 - 810 WP_001257044.1 invasion regulator SirB1 -
QCL60_RS13025 2685159..2685551 - 393 WP_000200392.1 invasion regulator SirB2 -
QCL60_RS13030 2685548..2686381 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T277148 WP_000170965.1 NZ_CP122517:2682129-2682236 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT277148 NZ_CP122517:c2682082-2682016 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References