Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 12380..12644 Replicon plasmid unnamed4
Accession NZ_CP122511
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QC806_RS26075 Protein ID WP_001387489.1
Coordinates 12380..12532 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 12584..12644 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS26045 (7646) 7646..9814 + 2169 WP_015508354.1 DotA/TraY family protein -
QC806_RS26050 (9885) 9885..10547 + 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
QC806_RS26055 (10619) 10619..10828 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
QC806_RS26060 (11220) 11220..11396 + 177 WP_001054900.1 hypothetical protein -
QC806_RS26065 (11461) 11461..11556 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QC806_RS26070 (12057) 12057..12308 + 252 WP_001291964.1 hypothetical protein -
QC806_RS26075 (12380) 12380..12532 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (12584) 12584..12644 + 61 NuclAT_0 - Antitoxin
- (12584) 12584..12644 + 61 NuclAT_0 - Antitoxin
- (12584) 12584..12644 + 61 NuclAT_0 - Antitoxin
- (12584) 12584..12644 + 61 NuclAT_0 - Antitoxin
QC806_RS26080 (13159) 13159..13938 + 780 WP_275450201.1 protein FinQ -
- (14008) 14008..14065 + 58 NuclAT_1 - -
- (14008) 14008..14065 + 58 NuclAT_1 - -
- (14008) 14008..14065 + 58 NuclAT_1 - -
- (14008) 14008..14065 + 58 NuclAT_1 - -
QC806_RS26085 (14245) 14245..15453 + 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
QC806_RS26090 (15472) 15472..16542 + 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..88955 88955


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T277125 WP_001387489.1 NZ_CP122511:c12532-12380 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT277125 NZ_CP122511:12584-12644 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References