Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 81526..82097 Replicon plasmid unnamed3
Accession NZ_CP122510
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QC806_RS25840 Protein ID WP_122791614.1
Coordinates 81816..82097 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QC806_RS25835 Protein ID WP_122791610.1
Coordinates 81526..81807 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS25805 76776..77756 - 981 WP_047647145.1 hypothetical protein -
QC806_RS25810 77760..78527 - 768 WP_000203293.1 hypothetical protein -
QC806_RS25815 78524..79315 - 792 WP_165474269.1 phage tail protein -
QC806_RS25820 79652..79852 + 201 WP_161527538.1 AlpA family phage regulatory protein -
QC806_RS25825 79910..81112 - 1203 WP_161527537.1 phage tail protein -
QC806_RS25830 81105..81434 - 330 WP_104076017.1 baseplate protein -
QC806_RS25835 81526..81807 - 282 WP_122791610.1 HigA family addiction module antitoxin Antitoxin
QC806_RS25840 81816..82097 - 282 WP_122791614.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC806_RS25845 82434..83087 - 654 WP_284632237.1 maturation control protein -
QC806_RS25850 83380..84255 + 876 WP_032273953.1 hypothetical protein -
QC806_RS25855 84296..84646 - 351 WP_000201621.1 hypothetical protein -
QC806_RS25860 84792..85076 - 285 WP_000717722.1 hypothetical protein -
QC806_RS25865 85367..86077 - 711 Protein_99 Rha family transcriptional regulator -
QC806_RS25870 86077..86292 - 216 WP_000201264.1 host cell division inhibitor Icd-like protein -
QC806_RS25875 86605..86772 - 168 WP_176685899.1 hypothetical protein -
QC806_RS25880 86806..86964 - 159 WP_155954547.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..96279 96279


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(3-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(1-86)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10590.14 Da        Isoelectric Point: 10.2589

>T277124 WP_122791614.1 NZ_CP122510:c82097-81816 [Escherichia coli]
MIKSFRHKGLERFFKTGSTAGIQAKHAIKLRIQLTALNAAKRPDDMSAPGWELHPLKGADLKGHWAISVNGNWRLTFRFE
GEDAILVDYQDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10112.57 Da        Isoelectric Point: 7.3179

>AT277124 WP_122791610.1 NZ_CP122510:c81807-81526 [Escherichia coli]
MSRMHNPAHPGAVLREYLGDISVTDAAAALGITRTALSRILNEKAGISADMALRLESALGTSAEMWTGMQSQYELWVASQ
TARPNIRPLFFHA

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References