Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3731049..3731743 | Replicon | chromosome |
Accession | NZ_CP122507 | ||
Organism | Escherichia coli strain W444 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | QC806_RS18395 | Protein ID | WP_001263493.1 |
Coordinates | 3731049..3731447 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | QC806_RS18400 | Protein ID | WP_000554757.1 |
Coordinates | 3731450..3731743 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3726709) | 3726709..3726789 | - | 81 | NuclAT_9 | - | - |
- (3726709) | 3726709..3726789 | - | 81 | NuclAT_9 | - | - |
- (3726709) | 3726709..3726789 | - | 81 | NuclAT_9 | - | - |
- (3726709) | 3726709..3726789 | - | 81 | NuclAT_9 | - | - |
QC806_RS18365 (3726049) | 3726049..3727293 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
QC806_RS18370 (3727385) | 3727385..3727843 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QC806_RS18375 (3728104) | 3728104..3729561 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
QC806_RS18380 (3729618) | 3729618..3730139 | - | 522 | Protein_3595 | peptide chain release factor H | - |
QC806_RS18385 (3730138) | 3730138..3730341 | - | 204 | Protein_3596 | RNA ligase RtcB family protein | - |
QC806_RS18390 (3730587) | 3730587..3731039 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
QC806_RS18395 (3731049) | 3731049..3731447 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QC806_RS18400 (3731450) | 3731450..3731743 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QC806_RS18405 (3731795) | 3731795..3732850 | - | 1056 | WP_063501914.1 | DNA polymerase IV | - |
QC806_RS18410 (3732921) | 3732921..3733706 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
QC806_RS18415 (3733678) | 3733678..3735390 | + | 1713 | Protein_3602 | flagellar biosynthesis protein FlhA | - |
QC806_RS18420 (3735614) | 3735614..3736111 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T277111 WP_001263493.1 NZ_CP122507:c3731447-3731049 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|