Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3731049..3731743 Replicon chromosome
Accession NZ_CP122507
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QC806_RS18395 Protein ID WP_001263493.1
Coordinates 3731049..3731447 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QC806_RS18400 Protein ID WP_000554757.1
Coordinates 3731450..3731743 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3726709) 3726709..3726789 - 81 NuclAT_9 - -
- (3726709) 3726709..3726789 - 81 NuclAT_9 - -
- (3726709) 3726709..3726789 - 81 NuclAT_9 - -
- (3726709) 3726709..3726789 - 81 NuclAT_9 - -
QC806_RS18365 (3726049) 3726049..3727293 - 1245 WP_000189541.1 esterase FrsA -
QC806_RS18370 (3727385) 3727385..3727843 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QC806_RS18375 (3728104) 3728104..3729561 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
QC806_RS18380 (3729618) 3729618..3730139 - 522 Protein_3595 peptide chain release factor H -
QC806_RS18385 (3730138) 3730138..3730341 - 204 Protein_3596 RNA ligase RtcB family protein -
QC806_RS18390 (3730587) 3730587..3731039 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QC806_RS18395 (3731049) 3731049..3731447 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QC806_RS18400 (3731450) 3731450..3731743 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QC806_RS18405 (3731795) 3731795..3732850 - 1056 WP_063501914.1 DNA polymerase IV -
QC806_RS18410 (3732921) 3732921..3733706 - 786 WP_000207564.1 putative lateral flagellar export/assembly protein LafU -
QC806_RS18415 (3733678) 3733678..3735390 + 1713 Protein_3602 flagellar biosynthesis protein FlhA -
QC806_RS18420 (3735614) 3735614..3736111 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277111 WP_001263493.1 NZ_CP122507:c3731447-3731049 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277111 WP_000554757.1 NZ_CP122507:c3731743-3731450 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References