Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2554..2818 Replicon plasmid unnamed2
Accession NZ_CP122505
Organism Escherichia coli strain W619

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag QC808_RS23955 Protein ID WP_001303307.1
Coordinates 2554..2706 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 2756..2818 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC808_RS23935 (1) 1..615 + 615 WP_000578649.1 plasmid IncI1-type surface exclusion protein ExcA -
QC808_RS23940 (713) 713..922 + 210 WP_001140545.1 hemolysin expression modulator Hha -
QC808_RS23945 (1131) 1131..1307 + 177 WP_001054900.1 hypothetical protein -
- (1793) 1793..1844 + 52 NuclAT_2 - -
- (1793) 1793..1844 + 52 NuclAT_2 - -
- (1793) 1793..1844 + 52 NuclAT_2 - -
- (1793) 1793..1844 + 52 NuclAT_2 - -
QC808_RS23950 (2231) 2231..2482 + 252 WP_001291968.1 hypothetical protein -
QC808_RS23955 (2554) 2554..2706 - 153 WP_001303307.1 Hok/Gef family protein Toxin
- (2756) 2756..2818 + 63 NuclAT_0 - Antitoxin
- (2756) 2756..2818 + 63 NuclAT_0 - Antitoxin
- (2756) 2756..2818 + 63 NuclAT_0 - Antitoxin
- (2756) 2756..2818 + 63 NuclAT_0 - Antitoxin
QC808_RS23960 (3333) 3333..4112 + 780 WP_275450201.1 protein FinQ -
- (4179) 4179..4239 + 61 NuclAT_1 - -
- (4179) 4179..4239 + 61 NuclAT_1 - -
- (4179) 4179..4239 + 61 NuclAT_1 - -
- (4179) 4179..4239 + 61 NuclAT_1 - -
QC808_RS23965 (4419) 4419..5627 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
QC808_RS23970 (5646) 5646..6716 + 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 / erm(B) - 1..100002 100002


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T277091 WP_001303307.1 NZ_CP122505:c2706-2554 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT277091 NZ_CP122505:2756-2818 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References