Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4670448..4671050 | Replicon | chromosome |
Accession | NZ_CP122503 | ||
Organism | Escherichia coli strain W619 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | QC808_RS22315 | Protein ID | WP_000897305.1 |
Coordinates | 4670739..4671050 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QC808_RS22310 | Protein ID | WP_000356397.1 |
Coordinates | 4670448..4670738 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC808_RS22285 (4666392) | 4666392..4667294 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QC808_RS22290 (4667291) | 4667291..4667926 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QC808_RS22295 (4667923) | 4667923..4668852 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QC808_RS22300 (4669182) | 4669182..4669424 | - | 243 | WP_001087409.1 | protein YiiF | - |
QC808_RS22305 (4669644) | 4669644..4669862 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
QC808_RS22310 (4670448) | 4670448..4670738 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QC808_RS22315 (4670739) | 4670739..4671050 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
QC808_RS22320 (4671279) | 4671279..4672187 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QC808_RS22325 (4672251) | 4672251..4673192 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QC808_RS22330 (4673237) | 4673237..4673674 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QC808_RS22335 (4673671) | 4673671..4674543 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QC808_RS22340 (4674537) | 4674537..4675136 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
QC808_RS22345 (4675235) | 4675235..4676020 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277089 WP_000897305.1 NZ_CP122503:c4671050-4670739 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|