Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 634849..635648 | Replicon | chromosome |
| Accession | NZ_CP122503 | ||
| Organism | Escherichia coli strain W619 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A161R7C1 |
| Locus tag | QC808_RS03050 | Protein ID | WP_000347278.1 |
| Coordinates | 634849..635313 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QC808_RS03055 | Protein ID | WP_001307405.1 |
| Coordinates | 635313..635648 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC808_RS03020 (629850) | 629850..630284 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QC808_RS03025 (630302) | 630302..631180 | - | 879 | WP_021557244.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QC808_RS03030 (631170) | 631170..631949 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QC808_RS03035 (631960) | 631960..632433 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QC808_RS03040 (632456) | 632456..633736 | - | 1281 | WP_021557243.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QC808_RS03045 (633985) | 633985..634794 | + | 810 | WP_000072174.1 | aga operon transcriptional regulator AgaR | - |
| QC808_RS03050 (634849) | 634849..635313 | - | 465 | WP_000347278.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QC808_RS03055 (635313) | 635313..635648 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QC808_RS03060 (635797) | 635797..637368 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QC808_RS03065 (637743) | 637743..639077 | + | 1335 | WP_000599633.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QC808_RS03070 (639093) | 639093..639863 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17866.28 Da Isoelectric Point: 9.6924
>T277074 WP_000347278.1 NZ_CP122503:c635313-634849 [Escherichia coli]
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A161R7C1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |