Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 55480..55744 Replicon plasmid unnamed2
Accession NZ_CP122501
Organism Escherichia coli strain W409

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QC809_RS24680 Protein ID WP_001387489.1
Coordinates 55480..55632 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 55684..55744 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC809_RS24650 (50746) 50746..52914 + 2169 WP_015508354.1 DotA/TraY family protein -
QC809_RS24655 (52985) 52985..53647 + 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
QC809_RS24660 (53719) 53719..53928 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
QC809_RS24665 (54320) 54320..54496 + 177 WP_001054900.1 hypothetical protein -
QC809_RS24670 (54561) 54561..54656 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QC809_RS24675 (55157) 55157..55408 + 252 WP_001291964.1 hypothetical protein -
QC809_RS24680 (55480) 55480..55632 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (55684) 55684..55744 + 61 NuclAT_0 - Antitoxin
- (55684) 55684..55744 + 61 NuclAT_0 - Antitoxin
- (55684) 55684..55744 + 61 NuclAT_0 - Antitoxin
- (55684) 55684..55744 + 61 NuclAT_0 - Antitoxin
QC809_RS24685 (56259) 56259..57038 + 780 WP_275450201.1 protein FinQ -
- (57108) 57108..57165 + 58 NuclAT_1 - -
- (57108) 57108..57165 + 58 NuclAT_1 - -
- (57108) 57108..57165 + 58 NuclAT_1 - -
- (57108) 57108..57165 + 58 NuclAT_1 - -
QC809_RS24690 (57345) 57345..58553 + 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
QC809_RS24695 (58572) 58572..59642 + 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..86106 86106


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T277069 WP_001387489.1 NZ_CP122501:c55632-55480 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT277069 NZ_CP122501:55684-55744 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References