Detailed information of TA system TA277064

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 71916..72342
• Replicon: plasmid unnamed1
• Accession: NZ_CP122500
• Organism: Escherichia coli strain W409

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QC809_RS23965
• Protein ID: WP_001372321.1
• Coordinates: 71916..72041 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	72118..72342 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QC809_RS23925 (67290)	67290..67979	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
QC809_RS23930 (68166)	68166..68549	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QC809_RS23935 (68870)	68870..69472	+	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
QC809_RS23940 (69769)	69769..70590	-	822	WP_001234426.1	DUF932 domain-containing protein	-
QC809_RS23945 (70708)	70708..70995	-	288	WP_000107535.1	hypothetical protein	-
QC809_RS23950 (71020)	71020..71226	-	207	WP_000547968.1	hypothetical protein	-
QC809_RS23955 (71296)	71296..71468	+	173	Protein_88	hypothetical protein	-
QC809_RS23960 (71466)	71466..71696	-	231	WP_071886920.1	hypothetical protein	-
QC809_RS23965 (71916)	71916..72041	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QC809_RS23970 (71983)	71983..72132	-	150	Protein_91	plasmid maintenance protein Mok	-
- (72118)	72118..72342	-	225	NuclAT_0	-	Antitoxin
- (72118)	72118..72342	-	225	NuclAT_0	-	Antitoxin
- (72118)	72118..72342	-	225	NuclAT_0	-	Antitoxin
- (72118)	72118..72342	-	225	NuclAT_0	-	Antitoxin
QC809_RS23975 (72154)	72154..72342	+	189	WP_001299721.1	hypothetical protein	-
QC809_RS23980 (72311)	72311..73073	-	763	Protein_93	plasmid SOS inhibition protein A	-
QC809_RS23985 (73070)	73070..73504	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
QC809_RS23990 (73559)	73559..73756	-	198	Protein_95	hypothetical protein	-
QC809_RS23995 (73784)	73784..74017	-	234	WP_000005990.1	DUF905 family protein	-
QC809_RS24000 (74085)	74085..74624	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
QC809_RS24005 (74650)	74650..74856	-	207	WP_000275856.1	hypothetical protein	-
QC809_RS24010 (75096)	75096..75353	-	258	WP_023147917.1	hypothetical protein	-
QC809_RS24015 (75266)	75266..75478	-	213	WP_001348622.1	hypothetical protein	-
QC809_RS24020 (75504)	75504..76069	-	566	Protein_101	class I SAM-dependent methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / sitABCD / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) / erm(B)	-	1..135934	135934

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277064 WP_001372321.1 NZ_CP122500:c72041-71916 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT277064 NZ_CP122500:c72342-72118 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin