Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31980..32234 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122500 | ||
| Organism | Escherichia coli strain W409 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QC809_RS23720 | Protein ID | WP_001312851.1 |
| Coordinates | 31980..32129 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 32173..32234 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC809_RS23690 (27227) | 27227..28138 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| QC809_RS23695 (28149) | 28149..29369 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| QC809_RS23700 (30076) | 30076..30690 | + | 615 | Protein_37 | VENN motif pre-toxin domain-containing protein | - |
| QC809_RS23705 (30690) | 30690..31136 | - | 447 | Protein_38 | plasmid replication initiator RepA | - |
| QC809_RS23710 (31129) | 31129..31203 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| QC809_RS23715 (31439) | 31439..31696 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| QC809_RS23720 (31980) | 31980..32129 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (32173) | 32173..32234 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (32173) | 32173..32234 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (32173) | 32173..32234 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (32173) | 32173..32234 | + | 62 | NuclAT_1 | - | Antitoxin |
| QC809_RS23725 (32373) | 32373..32555 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| QC809_RS23730 (32656) | 32656..33242 | + | 587 | Protein_43 | IS1-like element IS1B family transposase | - |
| QC809_RS23735 (33242) | 33242..34741 | - | 1500 | Protein_44 | IS66-like element ISCro1 family transposase | - |
| QC809_RS23740 (34761) | 34761..35108 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QC809_RS23745 (35108) | 35108..35785 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QC809_RS23750 (35840) | 35840..35929 | + | 90 | Protein_47 | IS1 family transposase | - |
| QC809_RS23755 (36230) | 36230..36442 | - | 213 | WP_005012601.1 | hypothetical protein | - |
| QC809_RS23760 (36576) | 36576..37136 | - | 561 | WP_000139363.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / sitABCD / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / mph(A) / erm(B) | - | 1..135934 | 135934 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T277060 WP_001312851.1 NZ_CP122500:c32129-31980 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT277060 NZ_CP122500:32173-32234 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
