Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3742032..3742726 Replicon chromosome
Accession NZ_CP122499
Organism Escherichia coli strain W409

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag QC809_RS18625 Protein ID WP_001263493.1
Coordinates 3742032..3742430 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag QC809_RS18630 Protein ID WP_000554757.1
Coordinates 3742433..3742726 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3737692) 3737692..3737772 - 81 NuclAT_10 - -
- (3737692) 3737692..3737772 - 81 NuclAT_10 - -
- (3737692) 3737692..3737772 - 81 NuclAT_10 - -
- (3737692) 3737692..3737772 - 81 NuclAT_10 - -
QC809_RS18595 (3737032) 3737032..3738276 - 1245 WP_000189541.1 esterase FrsA -
QC809_RS18600 (3738368) 3738368..3738826 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QC809_RS18605 (3739087) 3739087..3740544 + 1458 WP_063084593.1 cytosol nonspecific dipeptidase -
QC809_RS18610 (3740601) 3740601..3741122 - 522 Protein_3644 peptide chain release factor H -
QC809_RS18615 (3741121) 3741121..3741324 - 204 Protein_3645 RtcB family protein -
QC809_RS18620 (3741570) 3741570..3742022 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
QC809_RS18625 (3742032) 3742032..3742430 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QC809_RS18630 (3742433) 3742433..3742726 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QC809_RS18635 (3742778) 3742778..3743833 - 1056 WP_063084594.1 DNA polymerase IV -
QC809_RS18640 (3743904) 3743904..3744827 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
QC809_RS18645 (3744830) 3744830..3745693 - 864 WP_001169518.1 flagellar motor stator protein MotA -
QC809_RS18650 (3745706) 3745706..3746422 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
QC809_RS18655 (3746442) 3746442..3746909 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T277058 WP_001263493.1 NZ_CP122499:c3742430-3742032 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT277058 WP_000554757.1 NZ_CP122499:c3742726-3742433 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References