Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 733641..734334 | Replicon | chromosome |
| Accession | NZ_CP122499 | ||
| Organism | Escherichia coli strain W409 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | QC809_RS03635 | Protein ID | WP_063084548.1 |
| Coordinates | 733641..733937 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | QC809_RS03640 | Protein ID | WP_000650107.1 |
| Coordinates | 733939..734334 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC809_RS03600 (728729) | 728729..729043 | - | 315 | WP_063084545.1 | putative quinol monooxygenase | - |
| QC809_RS03605 (729074) | 729074..729655 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| QC809_RS03610 (729974) | 729974..730306 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| QC809_RS03615 (730352) | 730352..731701 | - | 1350 | WP_063084546.1 | quorum sensing histidine kinase QseC | - |
| QC809_RS03620 (731698) | 731698..732357 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| QC809_RS03625 (732509) | 732509..732901 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| QC809_RS03630 (732954) | 732954..733436 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| QC809_RS03635 (733641) | 733641..733937 | + | 297 | WP_063084548.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| QC809_RS03640 (733939) | 733939..734334 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| QC809_RS03645 (734467) | 734467..736074 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| QC809_RS03650 (736212) | 736212..738470 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11290.00 Da Isoelectric Point: 8.0440
>T277046 WP_063084548.1 NZ_CP122499:733641-733937 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELDLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELDLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT277046 WP_000650107.1 NZ_CP122499:733939-734334 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|