Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3616869..3617563 | Replicon | chromosome |
| Accession | NZ_CP122496 | ||
| Organism | Escherichia coli strain a7 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | QC805_RS17955 | Protein ID | WP_001263493.1 |
| Coordinates | 3616869..3617267 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | QC805_RS17960 | Protein ID | WP_000554757.1 |
| Coordinates | 3617270..3617563 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3612529) | 3612529..3612609 | - | 81 | NuclAT_13 | - | - |
| - (3612529) | 3612529..3612609 | - | 81 | NuclAT_13 | - | - |
| - (3612529) | 3612529..3612609 | - | 81 | NuclAT_13 | - | - |
| - (3612529) | 3612529..3612609 | - | 81 | NuclAT_13 | - | - |
| QC805_RS17925 (3611869) | 3611869..3613113 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| QC805_RS17930 (3613205) | 3613205..3613663 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| QC805_RS17935 (3613924) | 3613924..3615381 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| QC805_RS17940 (3615438) | 3615438..3615959 | - | 522 | Protein_3509 | peptide chain release factor H | - |
| QC805_RS17945 (3615958) | 3615958..3616161 | - | 204 | Protein_3510 | RtcB family protein | - |
| QC805_RS17950 (3616407) | 3616407..3616859 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| QC805_RS17955 (3616869) | 3616869..3617267 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QC805_RS17960 (3617270) | 3617270..3617563 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QC805_RS17965 (3617615) | 3617615..3618670 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| QC805_RS17970 (3618741) | 3618741..3619526 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| QC805_RS17975 (3619498) | 3619498..3621210 | + | 1713 | Protein_3516 | flagellar biosynthesis protein FlhA | - |
| QC805_RS17980 (3621405) | 3621405..3621932 | - | 528 | WP_284613952.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T277037 WP_001263493.1 NZ_CP122496:c3617267-3616869 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|