Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 586985..587784 | Replicon | chromosome |
| Accession | NZ_CP122496 | ||
| Organism | Escherichia coli strain a7 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | QC805_RS02900 | Protein ID | WP_000347273.1 |
| Coordinates | 586985..587449 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QC805_RS02905 | Protein ID | WP_001307405.1 |
| Coordinates | 587449..587784 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC805_RS02870 (581986) | 581986..582420 | - | 435 | WP_000948842.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QC805_RS02875 (582438) | 582438..583316 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QC805_RS02880 (583306) | 583306..584085 | - | 780 | WP_284614025.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QC805_RS02885 (584096) | 584096..584569 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QC805_RS02890 (584592) | 584592..585872 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QC805_RS02895 (586121) | 586121..586930 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QC805_RS02900 (586985) | 586985..587449 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QC805_RS02905 (587449) | 587449..587784 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QC805_RS02910 (587933) | 587933..589504 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
| QC805_RS02915 (589879) | 589879..591213 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QC805_RS02920 (591229) | 591229..591999 | + | 771 | WP_284614026.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 576429..598659 | 22230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T277026 WP_000347273.1 NZ_CP122496:c587449-586985 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |