Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2228016..2228233 | Replicon | chromosome |
Accession | NC_017763 | ||
Organism | Staphylococcus aureus subsp. aureus HO 5096 0412 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | SAEMRSA15_RS11315 | Protein ID | WP_075583739.1 |
Coordinates | 2228129..2228233 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2228016..2228071 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAEMRSA15_RS11295 | 2224072..2224737 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
SAEMRSA15_RS11300 | 2224889..2225209 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAEMRSA15_RS11305 | 2225211..2226191 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
SAEMRSA15_RS11310 | 2226457..2227548 | + | 1092 | WP_000495678.1 | hypothetical protein | - |
- | 2228016..2228071 | + | 56 | - | - | Antitoxin |
SAEMRSA15_RS11315 | 2228129..2228233 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
SAEMRSA15_RS14925 | 2228331..2228492 | - | 162 | Protein_2139 | helix-turn-helix domain-containing protein | - |
SAEMRSA15_RS15260 | 2228910..2229068 | + | 159 | WP_024928151.1 | hypothetical protein | - |
SAEMRSA15_RS11325 | 2229728..2230585 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
SAEMRSA15_RS11330 | 2230653..2231435 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T27702 WP_075583739.1 NC_017763:c2228233-2228129 [Staphylococcus aureus subsp. aureus HO 5096 0412]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
>T27702 NC_017763:c2228233-2228129 [Staphylococcus aureus subsp. aureus HO 5096 0412]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT27702 NC_017763:2228016-2228071 [Staphylococcus aureus subsp. aureus HO 5096 0412]
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|