Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 595165..595964 | Replicon | chromosome |
| Accession | NZ_CP122492 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A6H2GMC5 |
| Locus tag | QC807_RS02930 | Protein ID | WP_000347279.1 |
| Coordinates | 595165..595629 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QC807_RS02935 | Protein ID | WP_001307405.1 |
| Coordinates | 595629..595964 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS02900 (590166) | 590166..590600 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QC807_RS02905 (590618) | 590618..591496 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QC807_RS02910 (591486) | 591486..592265 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QC807_RS02915 (592276) | 592276..592749 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QC807_RS02920 (592772) | 592772..594052 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QC807_RS02925 (594301) | 594301..595110 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QC807_RS02930 (595165) | 595165..595629 | - | 465 | WP_000347279.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QC807_RS02935 (595629) | 595629..595964 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QC807_RS02940 (596113) | 596113..597684 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| QC807_RS02945 (598059) | 598059..599393 | + | 1335 | WP_128995326.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QC807_RS02950 (599409) | 599409..600179 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17869.24 Da Isoelectric Point: 9.4947
>T276996 WP_000347279.1 NZ_CP122492:c595629-595165 [Escherichia coli]
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
MDFPQRVNGWVLYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESFTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H2GMC5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |