Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 62334..62603 Replicon plasmid pBC16_IncFII
Accession NZ_CP122472
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_BC16

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag P9M40_RS28055 Protein ID WP_001372321.1
Coordinates 62478..62603 (+) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 62334..62399 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M40_RS28025 (58086) 58086..58571 + 486 WP_031311812.1 single-stranded DNA-binding protein -
P9M40_RS28030 (58629) 58629..58862 + 234 WP_000006003.1 DUF905 family protein -
P9M40_RS28035 (58923) 58923..60946 + 2024 Protein_69 ParB/RepB/Spo0J family partition protein -
P9M40_RS28040 (61015) 61015..61449 + 435 WP_000845953.1 conjugation system SOS inhibitor PsiB -
P9M40_RS28045 (61446) 61446..62165 + 720 WP_001276217.1 plasmid SOS inhibition protein A -
- (62334) 62334..62399 + 66 NuclAT_1 - -
- (62334) 62334..62399 - 66 NuclAT_0 - Antitoxin
- (62177) 62177..62401 + 225 NuclAT_0 - -
- (62177) 62177..62401 + 225 NuclAT_0 - -
- (62177) 62177..62401 + 225 NuclAT_0 - -
- (62177) 62177..62401 + 225 NuclAT_0 - -
- (62177) 62177..62401 - 225 NuclAT_0 - -
P9M40_RS28050 (62387) 62387..62536 + 150 Protein_72 plasmid maintenance protein Mok -
P9M40_RS28055 (62478) 62478..62603 + 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin Toxin
P9M40_RS28060 (62922) 62922..63218 - 297 Protein_74 hypothetical protein -
P9M40_RS28065 (63518) 63518..63814 + 297 WP_001272251.1 hypothetical protein -
P9M40_RS28070 (63925) 63925..64746 + 822 WP_001234445.1 DUF932 domain-containing protein -
P9M40_RS28075 (65043) 65043..65633 - 591 WP_000252683.1 transglycosylase SLT domain-containing protein -
P9M40_RS28080 (65968) 65968..66351 + 384 WP_001354030.1 conjugal transfer relaxosome DNA-binding protein TraM -
P9M40_RS28085 (66545) 66545..67216 + 672 WP_000283561.1 conjugal transfer transcriptional regulator TraJ -
P9M40_RS28090 (67353) 67353..67580 + 228 WP_000089263.1 conjugal transfer relaxosome protein TraY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(2-37)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4780.69 Da        Isoelectric Point: 8.5110

>T276992 WP_001372321.1 NZ_CP122472:62478-62603 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 126 bp

Antitoxin


Download         Length: 66 bp

>AT276992 NZ_CP122472:c62399-62334 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References