Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF2/- |
Location | 2048493..2048792 | Replicon | chromosome |
Accession | NC_017763 | ||
Organism | Staphylococcus aureus subsp. aureus HO 5096 0412 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAEMRSA15_RS14870 | Protein ID | WP_011447039.1 |
Coordinates | 2048616..2048792 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2048493..2048548 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAEMRSA15_RS10250 | 2043824..2044084 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAEMRSA15_RS10255 | 2044137..2044487 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
SAEMRSA15_RS10260 | 2045172..2045621 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAEMRSA15_RS15250 | 2045716..2046051 | - | 336 | Protein_1934 | SH3 domain-containing protein | - |
SAEMRSA15_RS10270 | 2046701..2047192 | - | 492 | WP_000919349.1 | staphylokinase | - |
SAEMRSA15_RS10275 | 2047383..2048138 | - | 756 | WP_000861039.1 | CHAP domain-containing protein | - |
SAEMRSA15_RS10280 | 2048150..2048404 | - | 255 | WP_000611512.1 | phage holin | - |
SAEMRSA15_RS14865 | 2048456..2048563 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2048485..2048624 | + | 140 | NuclAT_1 | - | - |
- | 2048485..2048624 | + | 140 | NuclAT_1 | - | - |
- | 2048485..2048624 | + | 140 | NuclAT_1 | - | - |
- | 2048485..2048624 | + | 140 | NuclAT_1 | - | - |
- | 2048493..2048548 | + | 56 | - | - | Antitoxin |
SAEMRSA15_RS14870 | 2048616..2048792 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAEMRSA15_RS10290 | 2048942..2049238 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAEMRSA15_RS10295 | 2049296..2049583 | - | 288 | WP_001040261.1 | hypothetical protein | - |
SAEMRSA15_RS10300 | 2049630..2049782 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAEMRSA15_RS10305 | 2049772..2053557 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2044137..2105082 | 60945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T27699 WP_011447039.1 NC_017763:c2048792-2048616 [Staphylococcus aureus subsp. aureus HO 5096 0412]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T27699 NC_017763:c2048792-2048616 [Staphylococcus aureus subsp. aureus HO 5096 0412]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT27699 NC_017763:2048493-2048548 [Staphylococcus aureus subsp. aureus HO 5096 0412]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|