Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 330116..330702 Replicon chromosome
Accession NZ_CP122461
Organism Klebsiella pneumoniae subsp. pneumoniae strain IITJ_U23

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag P9M41_RS01545 Protein ID WP_023285605.1
Coordinates 330334..330702 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P9M41_RS01540 Protein ID WP_004174006.1
Coordinates 330116..330337 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9M41_RS01520 (326273) 326273..327199 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P9M41_RS01525 (327196) 327196..328473 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P9M41_RS01530 (328470) 328470..329237 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P9M41_RS01535 (329239) 329239..329952 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P9M41_RS01540 (330116) 330116..330337 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P9M41_RS01545 (330334) 330334..330702 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P9M41_RS01550 (330975) 330975..332291 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P9M41_RS01555 (332398) 332398..333285 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P9M41_RS01560 (333282) 333282..334127 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P9M41_RS01565 (334129) 334129..335199 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327196..335936 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T276962 WP_023285605.1 NZ_CP122461:330334-330702 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT276962 WP_004174006.1 NZ_CP122461:330116-330337 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References