Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4582703..4583457 Replicon chromosome
Accession NZ_CP122457
Organism Salmonella enterica subsp. enterica strain TZ282

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QCX26_RS21950 Protein ID WP_000558162.1
Coordinates 4582703..4583014 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QCX26_RS21955 Protein ID WP_001259009.1
Coordinates 4583011..4583457 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCX26_RS21920 (4578369) 4578369..4579271 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
QCX26_RS21925 (4579268) 4579268..4579903 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
QCX26_RS21930 (4579900) 4579900..4580829 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
QCX26_RS21935 (4580867) 4580867..4581241 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin -
QCX26_RS21940 (4581241) 4581241..4581483 - 243 WP_001523745.1 CopG family transcriptional regulator -
QCX26_RS21945 (4581688) 4581688..4582617 + 930 WP_023234201.1 alpha/beta hydrolase -
QCX26_RS21950 (4582703) 4582703..4583014 + 312 WP_000558162.1 type II toxin-antitoxin system HigB family toxin Toxin
QCX26_RS21955 (4583011) 4583011..4583457 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
QCX26_RS21960 (4583472) 4583472..4584413 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
QCX26_RS21965 (4584458) 4584458..4584895 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
QCX26_RS21970 (4584892) 4584892..4585764 - 873 WP_000921423.1 virulence factor BrkB family protein -
QCX26_RS21975 (4585758) 4585758..4586357 - 600 WP_000965695.1 glucose-1-phosphatase -
QCX26_RS21980 (4586548) 4586548..4587351 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
QCX26_RS21985 (4587385) 4587385..4588281 - 897 WP_283880386.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12358.28 Da        Isoelectric Point: 9.3143

>T276959 WP_000558162.1 NZ_CP122457:4582703-4583014 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16720.06 Da        Isoelectric Point: 6.6451

>AT276959 WP_001259009.1 NZ_CP122457:4583011-4583457 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References