Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mqsRA (relBE)/MqsR-MqsA
Location 4078053..4078582 Replicon chromosome
Accession NZ_CP122457
Organism Salmonella enterica subsp. enterica strain TZ282

Toxin (Protein)


Gene name mqsR Uniprot ID -
Locus tag QCX26_RS19600 Protein ID WP_079984110.1
Coordinates 4078053..4078178 (+) Length 42 a.a.

Antitoxin (Protein)


Gene name mqsA Uniprot ID -
Locus tag QCX26_RS19605 Protein ID WP_079984109.1
Coordinates 4078181..4078582 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QCX26_RS19570 (4073336) 4073336..4073986 + 651 WP_283880317.1 TIGR03759 family integrating conjugative element protein -
QCX26_RS19575 (4073962) 4073962..4074495 + 534 WP_079984115.1 transglycosylase SLT domain-containing protein -
QCX26_RS19580 (4074492) 4074492..4074899 + 408 WP_079984114.1 integrating conjugative element protein -
QCX26_RS19585 (4074896) 4074896..4076929 + 2034 WP_079984113.1 type IV conjugative transfer system coupling protein TraD -
QCX26_RS19590 (4076892) 4076892..4077158 + 267 WP_079984112.1 hypothetical protein -
QCX26_RS19595 (4077158) 4077158..4077841 + 684 WP_079984111.1 TIGR03747 family integrating conjugative element membrane protein -
QCX26_RS19600 (4078053) 4078053..4078178 + 126 WP_079984110.1 type II toxin-antitoxin system MqsR family toxin Toxin
QCX26_RS19605 (4078181) 4078181..4078582 + 402 WP_079984109.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
QCX26_RS19610 (4078737) 4078737..4078966 + 230 Protein_3834 DUF4400 domain-containing protein -
QCX26_RS19615 (4079037) 4079037..4080086 - 1050 WP_176208043.1 ACR3 family arsenite efflux transporter -
QCX26_RS19620 (4080103) 4080103..4081884 - 1782 WP_079984108.1 arsenical pump-driving ATPase -
QCX26_RS19625 (4081929) 4081929..4082291 - 363 WP_080209424.1 arsenite efflux transporter metallochaperone ArsD -
QCX26_RS19630 (4082412) 4082412..4082912 - 501 Protein_3838 arsenic metallochaperone ArsD family protein -
QCX26_RS19635 (4083035) 4083035..4083511 - 477 WP_079984106.1 arsenate reductase ArsC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4052660..4124916 72256


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin MqsR

(1-40)

Antitoxin

Antitoxin MqsA/HigA-2

(1-131)


Sequences

Toxin        


Download         Length: 42 a.a.        Molecular weight: 4954.72 Da        Isoelectric Point: 4.8283

>T276956 WP_079984110.1 NZ_CP122457:4078053-4078178 [Salmonella enterica subsp. enterica]
MEAEKDPGYWQEVYRPTYLGQQIYLKFIVKDDVVIVSFKEK

Download         Length: 126 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14691.82 Da        Isoelectric Point: 6.4610

>AT276956 WP_079984109.1 NZ_CP122457:4078181-4078582 [Salmonella enterica subsp. enterica]
MKCPTCGGADLKHETRDVEYEYKGFKTIIRGITGDYCGTCGEAVLGDEAGDKYMAAITAFNRLVNAEEVDPAFIASVRKR
LKLDQRQAAEIFGGGVNAFSRYETGRVAPPRSLVLLFKALEKHPEILEEIKYA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References