Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1895456..1895636 | Replicon | chromosome |
Accession | NC_017763 | ||
Organism | Staphylococcus aureus subsp. aureus HO 5096 0412 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAEMRSA15_RS15220 | Protein ID | WP_001801861.1 |
Coordinates | 1895456..1895551 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1895579..1895636 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAEMRSA15_RS09265 | 1890743..1891510 | - | 768 | WP_001095317.1 | IS21-like element helper ATPase IstB | - |
SAEMRSA15_RS09270 | 1891522..1892757 | - | 1236 | WP_001215400.1 | IS21 family transposase | - |
SAEMRSA15_RS09275 | 1893115..1893684 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAEMRSA15_RS09280 | 1893870..1894055 | - | 186 | WP_000809864.1 | hypothetical protein | - |
SAEMRSA15_RS09285 | 1894057..1894233 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAEMRSA15_RS09290 | 1894244..1894627 | - | 384 | WP_000070809.1 | hypothetical protein | - |
SAEMRSA15_RS09295 | 1894809..1895033 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
SAEMRSA15_RS14800 | 1895207..1895311 | - | 105 | WP_001670380.1 | transposase | - |
SAEMRSA15_RS15220 | 1895456..1895551 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1895579..1895636 | - | 58 | - | - | Antitoxin |
SAEMRSA15_RS09300 | 1895674..1895775 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAEMRSA15_RS15225 | 1895753..1895925 | - | 173 | Protein_1788 | transposase | - |
SAEMRSA15_RS09305 | 1896119..1896496 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
SAEMRSA15_RS09310 | 1896702..1897142 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
SAEMRSA15_RS09315 | 1897187..1898800 | + | 1614 | WP_000926708.1 | lipase | - |
SAEMRSA15_RS09320 | 1898815..1899114 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
SAEMRSA15_RS09325 | 1899431..1900612 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | selk | 1866105..1911866 | 45761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T27695 WP_001801861.1 NC_017763:1895456-1895551 [Staphylococcus aureus subsp. aureus HO 5096 0412]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T27695 NC_017763:1895456-1895551 [Staphylococcus aureus subsp. aureus HO 5096 0412]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT27695 NC_017763:c1895636-1895579 [Staphylococcus aureus subsp. aureus HO 5096 0412]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|