Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4703644..4704443 | Replicon | chromosome |
| Accession | NZ_CP122454 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | QBY76_RS22830 | Protein ID | WP_087598199.1 |
| Coordinates | 4703979..4704443 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | QBY76_RS22825 | Protein ID | WP_087598198.1 |
| Coordinates | 4703644..4703979 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS22810 (4699429) | 4699429..4700199 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QBY76_RS22815 (4700215) | 4700215..4701549 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QBY76_RS22820 (4701924) | 4701924..4703495 | + | 1572 | WP_001273940.1 | galactarate dehydratase | - |
| QBY76_RS22825 (4703644) | 4703644..4703979 | + | 336 | WP_087598198.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QBY76_RS22830 (4703979) | 4703979..4704443 | + | 465 | WP_087598199.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QBY76_RS22835 (4704498) | 4704498..4705307 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QBY76_RS22840 (4705556) | 4705556..4706836 | + | 1281 | WP_052925113.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QBY76_RS22845 (4706859) | 4706859..4707332 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QBY76_RS22850 (4707343) | 4707343..4708122 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QBY76_RS22855 (4708112) | 4708112..4708990 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QBY76_RS22860 (4709008) | 4709008..4709442 | + | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17811.16 Da Isoelectric Point: 9.4947
>T276938 WP_087598199.1 NZ_CP122454:4703979-4704443 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|