Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1334579..1335273 | Replicon | chromosome |
| Accession | NZ_CP122454 | ||
| Organism | Escherichia coli strain 82.0311 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QBY76_RS06335 | Protein ID | WP_001263500.1 |
| Coordinates | 1334875..1335273 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QBY76_RS06330 | Protein ID | WP_000554758.1 |
| Coordinates | 1334579..1334872 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY76_RS06305 (1330017) | 1330017..1330514 | + | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
| QBY76_RS06310 (1330509) | 1330509..1330853 | - | 345 | WP_124072110.1 | hypothetical protein | - |
| QBY76_RS06315 (1330932) | 1330932..1332644 | - | 1713 | Protein_1232 | flagellar biosynthesis protein FlhA | - |
| QBY76_RS06320 (1332616) | 1332616..1333401 | + | 786 | WP_061336152.1 | putative lateral flagellar export/assembly protein LafU | - |
| QBY76_RS06325 (1333472) | 1333472..1334527 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QBY76_RS06330 (1334579) | 1334579..1334872 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QBY76_RS06335 (1334875) | 1334875..1335273 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QBY76_RS06340 (1335283) | 1335283..1335735 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QBY76_RS06345 (1335925) | 1335925..1337064 | + | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| QBY76_RS06350 (1337061) | 1337061..1337675 | + | 615 | WP_000602123.1 | peptide chain release factor H | - |
| QBY76_RS06355 (1337732) | 1337732..1339189 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QBY76_RS06360 (1339450) | 1339450..1339908 | + | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T276923 WP_001263500.1 NZ_CP122454:1334875-1335273 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|