Detailed information of TA system TA276919

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 52655..52924
• Replicon: plasmid p2
• Accession: NZ_CP122453
• Organism: Escherichia coli strain 82.0312

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QBY78_RS26255
• Protein ID: WP_001372321.1
• Coordinates: 52799..52924 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	52655..52720 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QBY78_RS26210 (47682)	47682..47951	+	270	WP_071977877.1	hypothetical protein	-
QBY78_RS26215 (48192)	48192..48398	+	207	WP_000547971.1	hypothetical protein	-
QBY78_RS26220 (48424)	48424..48963	+	540	WP_000290812.1	single-stranded DNA-binding protein	-
QBY78_RS26225 (49025)	49025..49258	+	234	WP_000006030.1	DUF905 family protein	-
QBY78_RS26230 (49323)	49323..51281	+	1959	WP_000117212.1	ParB/RepB/Spo0J family partition protein	-
QBY78_RS26235 (51336)	51336..51770	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
QBY78_RS26240 (51767)	51767..52529	+	763	Protein_59	plasmid SOS inhibition protein A	-
QBY78_RS26245 (52498)	52498..52686	-	189	WP_001299721.1	hypothetical protein	-
- (52655)	52655..52720	+	66	NuclAT_1	-	-
- (52498)	52498..52722	+	225	NuclAT_0	-	-
- (52498)	52498..52722	+	225	NuclAT_0	-	-
- (52498)	52498..52722	+	225	NuclAT_0	-	-
- (52498)	52498..52722	+	225	NuclAT_0	-	-
- (52498)	52498..52722	-	225	NuclAT_0	-	-
QBY78_RS26250 (52708)	52708..52857	+	150	Protein_61	plasmid maintenance protein Mok	-
QBY78_RS26255 (52799)	52799..52924	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QBY78_RS26260 (53144)	53144..53374	+	231	WP_074158030.1	hypothetical protein	-
QBY78_RS26265 (53372)	53372..53545	-	174	Protein_64	hypothetical protein	-
QBY78_RS26270 (53846)	53846..54133	+	288	WP_000107520.1	hypothetical protein	-
QBY78_RS26275 (54252)	54252..55073	+	822	WP_001234468.1	DUF932 domain-containing protein	-
QBY78_RS26280 (55369)	55369..55878	-	510	WP_000759163.1	transglycosylase SLT domain-containing protein	-
QBY78_RS26285 (56293)	56293..56676	+	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QBY78_RS26290 (56867)	56867..57553	+	687	WP_000332493.1	PAS domain-containing protein	-
QBY78_RS26295 (57647)	57647..57874	+	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B / aph(3')-Ia	-	1..93344	93344

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T276919 WP_001372321.1 NZ_CP122453:52799-52924 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT276919 NZ_CP122453:c52720-52655 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin