Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4005736..4006430 | Replicon | chromosome |
| Accession | NZ_CP122451 | ||
| Organism | Escherichia coli strain 82.0312 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QBY78_RS19655 | Protein ID | WP_001263500.1 |
| Coordinates | 4005736..4006134 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QBY78_RS19660 | Protein ID | WP_000554758.1 |
| Coordinates | 4006137..4006430 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY78_RS19630 (4001101) | 4001101..4001559 | - | 459 | WP_001291988.1 | xanthine phosphoribosyltransferase | - |
| QBY78_RS19635 (4001820) | 4001820..4003277 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QBY78_RS19640 (4003334) | 4003334..4003948 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| QBY78_RS19645 (4003945) | 4003945..4005084 | - | 1140 | WP_000521577.1 | RNA ligase RtcB family protein | - |
| QBY78_RS19650 (4005274) | 4005274..4005726 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QBY78_RS19655 (4005736) | 4005736..4006134 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QBY78_RS19660 (4006137) | 4006137..4006430 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QBY78_RS19665 (4006482) | 4006482..4007537 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QBY78_RS19670 (4007608) | 4007608..4008393 | - | 786 | WP_061336152.1 | putative lateral flagellar export/assembly protein LafU | - |
| QBY78_RS19675 (4008365) | 4008365..4010077 | + | 1713 | Protein_3862 | flagellar biosynthesis protein FlhA | - |
| QBY78_RS19680 (4010156) | 4010156..4010500 | + | 345 | WP_124072110.1 | hypothetical protein | - |
| QBY78_RS19685 (4010495) | 4010495..4010992 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T276911 WP_001263500.1 NZ_CP122451:c4006134-4005736 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|