Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1524734..1525033 | Replicon | chromosome |
| Accession | NC_017763 | ||
| Organism | Staphylococcus aureus subsp. aureus HO 5096 0412 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAEMRSA15_RS14730 | Protein ID | WP_011447039.1 |
| Coordinates | 1524857..1525033 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1524734..1524789 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAEMRSA15_RS15340 | 1519968..1520183 | - | 216 | WP_170267452.1 | hypothetical protein | - |
| SAEMRSA15_RS07305 | 1520362..1521372 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
| SAEMRSA15_RS07310 | 1521359..1523263 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
| SAEMRSA15_RS07320 | 1523624..1524379 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAEMRSA15_RS07325 | 1524391..1524645 | - | 255 | WP_000611512.1 | phage holin | - |
| SAEMRSA15_RS07330 | 1524697..1524804 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1524726..1524865 | + | 140 | NuclAT_0 | - | - |
| - | 1524726..1524865 | + | 140 | NuclAT_0 | - | - |
| - | 1524726..1524865 | + | 140 | NuclAT_0 | - | - |
| - | 1524726..1524865 | + | 140 | NuclAT_0 | - | - |
| - | 1524734..1524789 | + | 56 | - | - | Antitoxin |
| SAEMRSA15_RS14730 | 1524857..1525033 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAEMRSA15_RS07340 | 1525186..1525485 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| SAEMRSA15_RS07345 | 1525531..1525695 | - | 165 | WP_000916020.1 | XkdX family protein | - |
| SAEMRSA15_RS07350 | 1525688..1526077 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
| SAEMRSA15_RS07355 | 1526077..1527543 | - | 1467 | WP_000067127.1 | BppU family phage baseplate upper protein | - |
| SAEMRSA15_RS07360 | 1527543..1529453 | - | 1911 | WP_000429558.1 | minor structural protein | - |
| SAEMRSA15_RS07365 | 1529469..1529759 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1516430..1581203 | 64773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T27690 WP_011447039.1 NC_017763:c1525033-1524857 [Staphylococcus aureus subsp. aureus HO 5096 0412]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T27690 NC_017763:c1525033-1524857 [Staphylococcus aureus subsp. aureus HO 5096 0412]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGGTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT27690 NC_017763:1524734-1524789 [Staphylococcus aureus subsp. aureus HO 5096 0412]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
