Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 594657..595456 | Replicon | chromosome |
Accession | NZ_CP122451 | ||
Organism | Escherichia coli strain 82.0312 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | QBY78_RS02915 | Protein ID | WP_087598199.1 |
Coordinates | 594657..595121 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | QBY78_RS02920 | Protein ID | WP_087598198.1 |
Coordinates | 595121..595456 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QBY78_RS02885 (589658) | 589658..590092 | - | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QBY78_RS02890 (590110) | 590110..590988 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QBY78_RS02895 (590978) | 590978..591757 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QBY78_RS02900 (591768) | 591768..592241 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QBY78_RS02905 (592264) | 592264..593544 | - | 1281 | WP_052925113.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QBY78_RS02910 (593793) | 593793..594602 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QBY78_RS02915 (594657) | 594657..595121 | - | 465 | WP_087598199.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QBY78_RS02920 (595121) | 595121..595456 | - | 336 | WP_087598198.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QBY78_RS02925 (595605) | 595605..597176 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
QBY78_RS02930 (597551) | 597551..598885 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
QBY78_RS02935 (598901) | 598901..599671 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17811.16 Da Isoelectric Point: 9.4947
>T276896 WP_087598199.1 NZ_CP122451:c595121-594657 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDAFVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|