Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50411..50837 | Replicon | plasmid p2 |
| Accession | NZ_CP122450 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QBY77_RS25630 | Protein ID | WP_001372321.1 |
| Coordinates | 50712..50837 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50411..50635 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS25585 (45601) | 45601..45864 | + | 264 | WP_071781663.1 | hypothetical protein | - |
| QBY77_RS25590 (46105) | 46105..46311 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| QBY77_RS25595 (46337) | 46337..46876 | + | 540 | WP_000290812.1 | single-stranded DNA-binding protein | - |
| QBY77_RS25600 (46938) | 46938..47171 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| QBY77_RS25605 (47236) | 47236..49194 | + | 1959 | WP_000117212.1 | ParB/RepB/Spo0J family partition protein | - |
| QBY77_RS25610 (49249) | 49249..49683 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| QBY77_RS25615 (49680) | 49680..50442 | + | 763 | Protein_57 | plasmid SOS inhibition protein A | - |
| QBY77_RS25620 (50411) | 50411..50599 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (50568) | 50568..50633 | + | 66 | NuclAT_1 | - | - |
| - (50411) | 50411..50635 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50411) | 50411..50635 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50411) | 50411..50635 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50411) | 50411..50635 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (50411) | 50411..50635 | - | 225 | NuclAT_0 | - | - |
| QBY77_RS25625 (50621) | 50621..50770 | + | 150 | Protein_59 | plasmid maintenance protein Mok | - |
| QBY77_RS25630 (50712) | 50712..50837 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QBY77_RS25635 (51057) | 51057..51287 | + | 231 | WP_074158030.1 | hypothetical protein | - |
| QBY77_RS25640 (51285) | 51285..51458 | - | 174 | Protein_62 | hypothetical protein | - |
| QBY77_RS25645 (51759) | 51759..52046 | + | 288 | WP_000107520.1 | hypothetical protein | - |
| QBY77_RS25650 (52165) | 52165..52986 | + | 822 | WP_001234468.1 | DUF932 domain-containing protein | - |
| QBY77_RS25655 (53282) | 53282..53791 | - | 510 | WP_000759163.1 | transglycosylase SLT domain-containing protein | - |
| QBY77_RS25660 (54206) | 54206..54589 | + | 384 | WP_000124979.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QBY77_RS25665 (54780) | 54780..55466 | + | 687 | WP_000332493.1 | PAS domain-containing protein | - |
| QBY77_RS25670 (55560) | 55560..55787 | + | 228 | WP_001254385.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / tet(B) / blaTEM-1B | - | 1..91257 | 91257 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T276894 WP_001372321.1 NZ_CP122450:50712-50837 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT276894 NZ_CP122450:50411-50635 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|