Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4903273..4903875 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QBY77_RS23620 | Protein ID | WP_000897305.1 |
| Coordinates | 4903564..4903875 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QBY77_RS23615 | Protein ID | WP_000356397.1 |
| Coordinates | 4903273..4903563 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS23595 (4899775) | 4899775..4900677 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QBY77_RS23600 (4900674) | 4900674..4901309 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QBY77_RS23605 (4901306) | 4901306..4902235 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| QBY77_RS23610 (4902450) | 4902450..4902668 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
| QBY77_RS23615 (4903273) | 4903273..4903563 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QBY77_RS23620 (4903564) | 4903564..4903875 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QBY77_RS23625 (4904104) | 4904104..4905012 | + | 909 | WP_001298596.1 | alpha/beta hydrolase | - |
| QBY77_RS23630 (4905076) | 4905076..4906017 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QBY77_RS23635 (4906062) | 4906062..4906499 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QBY77_RS23640 (4906496) | 4906496..4907368 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QBY77_RS23645 (4907362) | 4907362..4907961 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12172.16 Da Isoelectric Point: 9.7791
>T276891 WP_000897305.1 NZ_CP122448:c4903875-4903564 [Escherichia coli]
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|