Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 4294420..4294832 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | QBY77_RS20790 | Protein ID | WP_000132614.1 |
| Coordinates | 4294491..4294832 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 4294420..4294496 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS20780 (4291095) | 4291095..4292564 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
| QBY77_RS20785 (4292564) | 4292564..4294270 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4294420) | 4294420..4294496 | - | 77 | NuclAT_7 | - | Antitoxin |
| QBY77_RS20790 (4294491) | 4294491..4294832 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| QBY77_RS20795 (4294879) | 4294879..4296042 | - | 1164 | WP_072002093.1 | DUF1524 domain-containing protein | - |
| QBY77_RS20800 (4296090) | 4296090..4296972 | - | 883 | Protein_4076 | DUF262 domain-containing protein | - |
| QBY77_RS20805 (4297162) | 4297162..4297239 | + | 78 | Protein_4077 | hypothetical protein | - |
| QBY77_RS20810 (4297378) | 4297378..4298298 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| QBY77_RS20815 (4298483) | 4298483..4299763 | + | 1281 | WP_001298033.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4278299..4297035 | 18736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T276885 WP_000132614.1 NZ_CP122448:4294491-4294832 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT276885 NZ_CP122448:c4294496-4294420 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|