Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4169196..4169454 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | QBY77_RS20115 | Protein ID | WP_000809168.1 |
| Coordinates | 4169302..4169454 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4169196..4169253 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS20100 | 4165025..4166284 | - | 1260 | WP_000494927.1 | hypothetical protein | - |
| QBY77_RS20105 | 4166413..4167906 | - | 1494 | WP_001314416.1 | sulfatase-like hydrolase/transferase | - |
| QBY77_RS20110 | 4167926..4168687 | - | 762 | WP_001274828.1 | outer membrane protein OmpK | - |
| - | 4169196..4169253 | - | 58 | - | - | Antitoxin |
| QBY77_RS20115 | 4169302..4169454 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| QBY77_RS20120 | 4169559..4170689 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| QBY77_RS20125 | 4170778..4172694 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| QBY77_RS20130 | 4173066..4173470 | + | 405 | WP_000843689.1 | DUF2541 family protein | - |
| QBY77_RS20135 | 4173496..4174209 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T276884 WP_000809168.1 NZ_CP122448:4169302-4169454 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT276884 NZ_CP122448:c4169253-4169196 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|