Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3900806..3901500 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | QBY77_RS18870 | Protein ID | WP_001263500.1 |
| Coordinates | 3900806..3901204 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | QBY77_RS18875 | Protein ID | WP_000554758.1 |
| Coordinates | 3901207..3901500 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS18845 (3896171) | 3896171..3896629 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| QBY77_RS18850 (3896890) | 3896890..3898347 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| QBY77_RS18855 (3898404) | 3898404..3899018 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
| QBY77_RS18860 (3899015) | 3899015..3900154 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| QBY77_RS18865 (3900344) | 3900344..3900796 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| QBY77_RS18870 (3900806) | 3900806..3901204 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QBY77_RS18875 (3901207) | 3901207..3901500 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QBY77_RS18880 (3901552) | 3901552..3902607 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| QBY77_RS18885 (3902678) | 3902678..3903463 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
| QBY77_RS18890 (3903435) | 3903435..3905147 | + | 1713 | Protein_3704 | flagellar biosynthesis protein FlhA | - |
| QBY77_RS18895 (3905175) | 3905175..3905384 | + | 210 | WP_071778446.1 | hypothetical protein | - |
| QBY77_RS18900 (3905467) | 3905467..3905964 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3900806..3921160 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T276882 WP_001263500.1 NZ_CP122448:c3901204-3900806 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|