Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 627783..628582 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q8FDB4 |
| Locus tag | QBY77_RS03105 | Protein ID | WP_000347252.1 |
| Coordinates | 627783..628247 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QBY77_RS03110 | Protein ID | WP_001296435.1 |
| Coordinates | 628247..628582 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS03075 (622784) | 622784..623218 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QBY77_RS03080 (623236) | 623236..624114 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QBY77_RS03085 (624104) | 624104..624883 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QBY77_RS03090 (624894) | 624894..625367 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QBY77_RS03095 (625390) | 625390..626670 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QBY77_RS03100 (626919) | 626919..627728 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QBY77_RS03105 (627783) | 627783..628247 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QBY77_RS03110 (628247) | 628247..628582 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QBY77_RS03115 (628731) | 628731..630302 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
| QBY77_RS03120 (630677) | 630677..632011 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QBY77_RS03125 (632027) | 632027..632797 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T276867 WP_000347252.1 NZ_CP122448:c628247-627783 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|