Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 207860..208082 | Replicon | chromosome |
| Accession | NZ_CP122448 | ||
| Organism | Escherichia coli strain 85.0412 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | QBY77_RS01025 | Protein ID | WP_001295224.1 |
| Coordinates | 207975..208082 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 207860..207926 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBY77_RS01005 | 203301..204203 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| QBY77_RS01010 | 204214..205197 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| QBY77_RS01015 | 205194..206198 | + | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| QBY77_RS01020 | 206228..207499 | - | 1272 | WP_001298005.1 | aromatic amino acid transport family protein | - |
| - | 207860..207926 | - | 67 | - | - | Antitoxin |
| QBY77_RS01025 | 207975..208082 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| QBY77_RS01030 | 208169..209848 | - | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
| QBY77_RS01035 | 209845..210036 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| QBY77_RS01040 | 210033..211604 | - | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| QBY77_RS01045 | 211877..212065 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| QBY77_RS01050 | 212077..212829 | + | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T276866 WP_001295224.1 NZ_CP122448:207975-208082 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT276866 NZ_CP122448:c207926-207860 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|