Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 207860..208082 Replicon chromosome
Accession NZ_CP122448
Organism Escherichia coli strain 85.0412

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag QBY77_RS01025 Protein ID WP_001295224.1
Coordinates 207975..208082 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 207860..207926 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QBY77_RS01005 203301..204203 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
QBY77_RS01010 204214..205197 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
QBY77_RS01015 205194..206198 + 1005 WP_000103577.1 dipeptide ABC transporter ATP-binding subunit DppF -
QBY77_RS01020 206228..207499 - 1272 WP_001298005.1 aromatic amino acid transport family protein -
- 207860..207926 - 67 - - Antitoxin
QBY77_RS01025 207975..208082 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
QBY77_RS01030 208169..209848 - 1680 WP_000191565.1 cellulose biosynthesis protein BcsG -
QBY77_RS01035 209845..210036 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
QBY77_RS01040 210033..211604 - 1572 WP_001204945.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
QBY77_RS01045 211877..212065 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
QBY77_RS01050 212077..212829 + 753 WP_000279536.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T276866 WP_001295224.1 NZ_CP122448:207975-208082 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT276866 NZ_CP122448:c207926-207860 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References