Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 363133..363670 | Replicon | chromosome |
Accession | NZ_CP122407 | ||
Organism | Rugamonas sp. DEMB1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | QC826_RS01645 | Protein ID | WP_279764123.1 |
Coordinates | 363133..363429 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | QC826_RS01650 | Protein ID | WP_279764124.1 |
Coordinates | 363431..363670 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC826_RS01630 (QC826_01630) | 359077..360681 | + | 1605 | WP_279764120.1 | lipase family protein | - |
QC826_RS01635 (QC826_01635) | 360875..362251 | + | 1377 | WP_279764121.1 | SGNH/GDSL hydrolase family protein | - |
QC826_RS01640 (QC826_01640) | 362317..362997 | + | 681 | WP_279764122.1 | OmpW family outer membrane protein | - |
QC826_RS01645 (QC826_01645) | 363133..363429 | + | 297 | WP_279764123.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
QC826_RS01650 (QC826_01650) | 363431..363670 | + | 240 | WP_279764124.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
QC826_RS01655 (QC826_01655) | 363749..364933 | - | 1185 | WP_279764125.1 | acyl-CoA dehydrogenase | - |
QC826_RS01660 (QC826_01660) | 365078..365581 | - | 504 | WP_093382053.1 | flavin reductase family protein | - |
QC826_RS01665 (QC826_01665) | 365789..366664 | + | 876 | WP_279764126.1 | alpha/beta hydrolase | - |
QC826_RS01670 (QC826_01670) | 366780..367139 | - | 360 | WP_279764127.1 | hypothetical protein | - |
QC826_RS01675 (QC826_01675) | 367425..367991 | + | 567 | WP_093382058.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10795.65 Da Isoelectric Point: 10.0270
>T276839 WP_279764123.1 NZ_CP122407:363133-363429 [Rugamonas sp. DEMB1]
MEKISPHYSLPKVKALIDEGRVASTFSALTGAAALGIDFAGMVAIVKALTRRDFYKSMTSRADHHIWQDVYRPSTPVGKV
YLKLTVVDGVLIVSFKEL
MEKISPHYSLPKVKALIDEGRVASTFSALTGAAALGIDFAGMVAIVKALTRRDFYKSMTSRADHHIWQDVYRPSTPVGKV
YLKLTVVDGVLIVSFKEL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|