Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3958102..3958699 | Replicon | chromosome |
| Accession | NZ_CP122389 | ||
| Organism | Klebsiella pneumoniae strain KP9650 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | QCB43_RS19480 | Protein ID | WP_004142563.1 |
| Coordinates | 3958382..3958699 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | QCB43_RS19475 | Protein ID | WP_004142561.1 |
| Coordinates | 3958102..3958389 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCB43_RS19445 (QCB43_19445) | 3954182..3954430 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| QCB43_RS19450 (QCB43_19450) | 3954448..3954789 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| QCB43_RS19455 (QCB43_19455) | 3954820..3955935 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| QCB43_RS19460 (QCB43_19460) | 3956115..3956696 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| QCB43_RS19465 (QCB43_19465) | 3956696..3957064 | + | 369 | WP_279510798.1 | MmcQ/YjbR family DNA-binding protein | - |
| QCB43_RS19470 (QCB43_19470) | 3957184..3957837 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| QCB43_RS19475 (QCB43_19475) | 3958102..3958389 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QCB43_RS19480 (QCB43_19480) | 3958382..3958699 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QCB43_RS19485 (QCB43_19485) | 3958884..3959927 | - | 1044 | WP_023300815.1 | DUF2157 domain-containing protein | - |
| QCB43_RS19490 (QCB43_19490) | 3960593..3961459 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| QCB43_RS19495 (QCB43_19495) | 3961568..3962995 | + | 1428 | WP_023300814.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T276821 WP_004142563.1 NZ_CP122389:c3958699-3958382 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |