Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 794869..795644 | Replicon | chromosome |
Accession | NZ_CP122389 | ||
Organism | Klebsiella pneumoniae strain KP9650 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QCB43_RS03975 | Protein ID | WP_004150910.1 |
Coordinates | 795159..795644 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QCB43_RS03970 | Protein ID | WP_004150912.1 |
Coordinates | 794869..795162 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCB43_RS03950 (QCB43_03950) | 790077..790679 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
QCB43_RS03955 (QCB43_03955) | 790777..791688 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
QCB43_RS03960 (QCB43_03960) | 791689..792837 | - | 1149 | WP_016947441.1 | PLP-dependent aspartate aminotransferase family protein | - |
QCB43_RS03965 (QCB43_03965) | 792848..794224 | - | 1377 | WP_023301305.1 | pyridoxal-phosphate dependent enzyme | - |
QCB43_RS03970 (QCB43_03970) | 794869..795162 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QCB43_RS03975 (QCB43_03975) | 795159..795644 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QCB43_RS03980 (QCB43_03980) | 796348..796941 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QCB43_RS03985 (QCB43_03985) | 797038..797254 | + | 217 | Protein_784 | transposase | - |
QCB43_RS03990 (QCB43_03990) | 797861..798733 | + | 873 | WP_004188557.1 | ParA family protein | - |
QCB43_RS03995 (QCB43_03995) | 798733..799116 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QCB43_RS04000 (QCB43_04000) | 799109..800476 | + | 1368 | WP_023301304.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 797038..797190 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T276814 WP_004150910.1 NZ_CP122389:795159-795644 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |